Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2Y purinoceptor 1
LigandBDBM50118229
Substrate/Competitorn/a
Meas. Tech.ChEMBL_147722
IC50 331±n/a nM
Citation Nandanan ECamaioni EJang SYKim YCCristalli GHerdewijn PSecrist JATiwari KNMohanram AHarden TKBoyer JLJacobson KA Structure-activity relationships of bisphosphate nucleotide derivatives as P2Y1 receptor antagonists and partial agonists. J Med Chem 42:1625-38 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
P2Y purinoceptor 1
Name:P2Y purinoceptor 1
Synonyms:n/a
Type:n/a
Mol. Mass.:41199.64
Organism:Meleagris gallopavo
Description:n/a
Residue:362
Sequence:
MTEALISAALNGTQPELLAGGWAAGNASTKCSLTKTGFQFYYLPTVYILVFITGFLGNSV
AIWMFVFHMRPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDVMCKLQRFIF
HVNLYGSILFLTCISVHRYTGVVHPLKSLGRLKKKNAVYVSSLVWALVVAVIAPILFYSG
TGVRRNKTITCYDTTADEYLRSYFVYSMCTTVFMFCIPFIVILGCYGLIVKALIYKDLDN
SPLRRKSIYLVIIVLTVFAVSYLPFHVMKTLNLRARLDFQTPQMCAFNDKVYATYQVTRG
LASLNSCVDPILYFLAGDTFRRRLSRATRKSSRRSEPNVQSKSEEMTLNILTEYKQNGDT
SL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118229
n/a
NameBDBM50118229
Synonyms:CHEMBL129841 | MRS 2179
TypeSmall organic molecule
Emp. Form.C11H17N5O9P2
Mol. Mass.425.2283
SMILESCNc1ncnc2n(cnc12)[C@H]1C[C@H](OP(O)(O)=O)[C@@H](COP(O)(O)=O)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: