Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 integrase
LigandBDBM50088355
Substrate/Competitorn/a
Meas. Tech.ChEMBL_88616
IC50 4100±n/a nM
Citation Carlson HAMasukawa KMRubins KBushman FDJorgensen WLLins RDBriggs JMMcCammon JA Developing a dynamic pharmacophore model for HIV-1 integrase. J Med Chem 43:2100-14 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 integrase
Name:Human immunodeficiency virus type 1 integrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32231.48
Organism:Human immunodeficiency virus 1
Description:ChEMBL_90865
Residue:288
Sequence:
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50088355
n/a
NameBDBM50088355
Synonyms:10-(4-Amino-5-hydroxy-6-methyl-tetrahydro-pyran-2-yloxy)-1,6,8,11-tetrahydroxy-8-(2-hydroxy-acetyl)-7,8,9,10-tetrahydro-naphthacene-5,12-dione; compound with methane | CHEMBL541123
TypeSmall organic molecule
Emp. Form.C26H27NO11
Mol. Mass.529.4927
SMILESC[C@@H]1O[C@H](C[C@H](N)[C@@H]1O)OC1C[C@@](O)(Cc2c(O)c3C(=O)c4cccc(O)c4C(=O)c3c(O)c12)C(=O)CO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: