Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 integrase
LigandBDBM50041419
Substrate/Competitorn/a
Meas. Tech.ChEMBL_88616
IC50 1000±n/a nM
Citation Carlson HAMasukawa KMRubins KBushman FDJorgensen WLLins RDBriggs JMMcCammon JA Developing a dynamic pharmacophore model for HIV-1 integrase. J Med Chem 43:2100-14 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 integrase
Name:Human immunodeficiency virus type 1 integrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32231.48
Organism:Human immunodeficiency virus 1
Description:ChEMBL_90865
Residue:288
Sequence:
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041419
n/a
NameBDBM50041419
Synonyms:1,2,5,8-tetrahydroxy-9,10-anthracenedione | 1,2,5,8-tetrahydroxy-9,10-anthraquinone | 1,2,5,8-tetrahydroxyanthra-9,10-quinone | 1,2,5,8-tetrahydroxyanthracene-9,10-dione | 1,2,5,8-tetrahydroxyanthraquinone | 1,4,5,6-tetrahydroxyanthraquinone | Alizarinbordeaux | Alizarine Bordeaux B | CHEMBL29898 | Quinalizarin, E | quinalizarin
TypeSmall organic molecule
Emp. Form.C14H8O6
Mol. Mass.272.2097
SMILESOc1ccc2C(=O)c3c(O)ccc(O)c3C(=O)c2c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: