Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 integrase
LigandBDBM5149
Substrate/Competitorn/a
Meas. Tech.ChEMBL_88615
IC50 10000±n/a nM
Citation Carlson HAMasukawa KMRubins KBushman FDJorgensen WLLins RDBriggs JMMcCammon JA Developing a dynamic pharmacophore model for HIV-1 integrase. J Med Chem 43:2100-14 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 integrase
Name:Human immunodeficiency virus type 1 integrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32231.48
Organism:Human immunodeficiency virus 1
Description:ChEMBL_90865
Residue:288
Sequence:
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5149
n/a
NameBDBM5149
Synonyms:(2E)-2-cyano-N-{3-[(2E)-2-cyano-3-(3,4-dihydroxyphenyl)prop-2-enamido]propyl}-3-(3,4-dihydroxyphenyl)prop-2-enamide | CHEMBL67535 | Dimeric Tyrphostin 2
TypeSmall organic molecule
Emp. Form.C23H20N4O6
Mol. Mass.448.4281
SMILESOc1ccc(\C=C(/C#N)C(=O)NCCCNC(=O)C(=C\c2ccc(O)c(O)c2)\C#N)cc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: