Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM517 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_159325 (CHEMBL769378) |
---|
IC50 | 0.41±n/a nM |
---|
Citation | Dorsey, BD; McDonough, C; McDaniel, SL; Levin, RB; Newton, CL; Hoffman, JM; Darke, PL; Zugay-Murphy, JA; Emini, EA; Schleif, WA; Olsen, DB; Stahlhut, MW; Rutkowski, CA; Kuo, LC; Lin, JH; Chen, IW; Michelson, SR; Holloway, MK; Huff, JR; Vacca, JP Identification of MK-944a: a second clinical candidate from the hydroxylaminepentanamide isostere series of HIV protease inhibitors. J Med Chem43:3386-99 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM517 |
---|
n/a |
---|
Name | BDBM517 |
Synonyms: | (2S)-1-[(2S,4R)-4-benzyl-2-hydroxy-4-{[(1S,2R)-2-hydroxy-2,3-dihydro-1H-inden-1-yl]carbamoyl}butyl]-N-tert-butyl-4-(pyridin-3-ylmethyl)piperazine-2-carboxamide | CHEMBL115 | Crixivan | INDINAVIR SULFATE | Indinavir | Indinavir, 19 | L-735, 524 | MK639 |
Type | Small organic molecule |
Emp. Form. | C36H47N5O4 |
Mol. Mass. | 613.7895 |
SMILES | CC(C)(C)NC(=O)[C@@H]1CN(Cc2cccnc2)CCN1C[C@@H](O)C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12 |@:19,@@:9| |
Structure |
|