| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50092152 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_196355 (CHEMBL878547) |
|---|
| IC50 | 56±n/a nM |
|---|
| Citation |  Tyndall, JD; Reid, RC; Tyssen, DP; Jardine, DK; Todd, B; Passmore, M; March, DR; Pattenden, LK; Bergman, DA; Alewood, D; Hu, SH; Alewood, PF; Birch, CJ; Martin, JL; Fairlie, DP Synthesis, stability, antiviral activity, and protease-bound structures of substrate-mimicking constrained macrocyclic inhibitors of HIV-1 protease. J Med Chem43:3495-504 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50092152 |
|---|
| n/a |
|---|
| Name | BDBM50092152 |
|---|
| Synonyms: | 2-Benzyl-5-(10-sec-butyl-9,12-dioxo-2-oxa-8,11-diaza-bicyclo[13.2.2]nonadeca-1(18),15(19),16-trien-13-ylamino)-4-hydroxy-pentanoic acid (2-hydroxy-indan-1-yl)-amide | CHEMBL331945 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C41H54N4O6 |
|---|
| Mol. Mass. | 698.8907 |
|---|
| SMILES | CCC(C)[C@@H]1NC(=O)[C@H](Cc2ccc(OCCCCCNC1=O)cc2)NC[C@@H](O)C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
