Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50369584 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_196355 (CHEMBL878547) |
---|
IC50 | 95±n/a nM |
---|
Citation | Tyndall, JD; Reid, RC; Tyssen, DP; Jardine, DK; Todd, B; Passmore, M; March, DR; Pattenden, LK; Bergman, DA; Alewood, D; Hu, SH; Alewood, PF; Birch, CJ; Martin, JL; Fairlie, DP Synthesis, stability, antiviral activity, and protease-bound structures of substrate-mimicking constrained macrocyclic inhibitors of HIV-1 protease. J Med Chem43:3495-504 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50369584 |
---|
n/a |
---|
Name | BDBM50369584 |
Synonyms: | CHEMBL1790230 |
Type | Small organic molecule |
Emp. Form. | C43H54N6O6 |
Mol. Mass. | 750.9255 |
SMILES | CC[C@@H](C)[C@@H]1NC(=O)[C@H](Cc2ccc(OCCCNC1=O)cc2)NC[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)c1ccc2ccccc2n1)C(C)C |
Structure |
|