Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50035947
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63838
Ki 9.4±n/a nM
Citation Leung DAbbenante GFairlie DP Protease inhibitors: current status and future prospects. J Med Chem 43:305-41 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50035947
n/a
NameBDBM50035947
Synonyms:2-{3-[4-(4-Chloro-benzenesulfonylaminocarbonyl)-benzenesulfonylamino]-2-oxo-6-phenyl-2H-pyridin-1-yl}-N-(3,3,3-trifluoro-1-isopropyl-2-oxo-propyl)-acetamide | CHEMBL303493
TypeSmall organic molecule
Emp. Form.C32H28ClF3N4O8S2
Mol. Mass.753.165
SMILESCC(C)C(NC(=O)Cn1c(ccc(NS(=O)(=O)c2ccc(cc2)C(=O)NS(=O)(=O)c2ccc(Cl)cc2)c1=O)-c1ccccc1)C(=O)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: