Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin-converting enzyme 1 (ECE1)
LigandBDBM50084905
Substrate/Competitorn/a
Meas. Tech.ChEMBL_225950
IC50 2.6±n/a nM
Citation De Lombaert SBlanchard LStamford LBTan JWallace EMSatoh YFitt JHoyer DSimonsbergen DMoliterni JMarcopoulos NSavage PChou MTrapani AJJeng AY Potent and selective non-peptidic inhibitors of endothelin-converting enzyme-1 with sustained duration of action. J Med Chem 43:488-504 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Endothelin-converting enzyme 1 (ECE1)
Name:Endothelin-converting enzyme 1
Synonyms:ECE-1 | Endothelin-Converting Enzyme 1
Type:Enzyme
Mol. Mass.:87155.11
Organism:Homo sapiens (Human)
Description:P42892
Residue:770
Sequence:
MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFHSPRSGQRCWA
ARTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMDPTVD
PCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQV
YYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQDTLQVVTAHYRTSPFFSVY
VSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGYLNYMVQLGKLLGGGDEEAI
RPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLPFLNTIFYPVE
INESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEV
MYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILEIKKAFEESLS
TLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNF
SWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGG
IGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKRQTECMVEQYSNYSVNGEPVN
GRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLFFLGFAQVWCSVRTP
ESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50084905
n/a
NameBDBM50084905
Synonyms:CHEMBL147964 | {1-[2-Dibenzofuran-3-yl-1-(1H-tetrazol-5-yl)-ethylamino]-3-naphthalen-1-yl-propyl}-phosphonic acid
TypeSmall organic molecule
Emp. Form.C28H26N5O4P
Mol. Mass.527.5109
SMILESOP(O)(=O)C(CCc1cccc2ccccc12)N[C@@H](Cc1ccc2c(c1)oc1ccccc21)c1nnn[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: