Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 4
LigandBDBM50085147
Substrate/Competitorn/a
Meas. Tech.ChEMBL_155173
IC50 340±n/a nM
Citation Hersperger RBray-French KMazzoni LMüller T Palladium-catalyzed cross-coupling reactions for the synthesis of 6, 8-disubstituted 1,7-naphthyridines: a novel class of potent and selective phosphodiesterase type 4D inhibitors. J Med Chem 43:675-82 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 4
Name:Phosphodiesterase 4
Synonyms:Phosphodiesterase 4B | cAMP-specific 3'',5''-cyclic phosphodiesterase 4B
Type:Enzyme Catalytic Domain
Mol. Mass.:83349.50
Organism:RAT
Description:Phosphodiesterase 4 0 RAT::P14646
Residue:736
Sequence:
MKKSRSVMAVTADDNLKDYFECSLSKSYSSSSYTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSSGLVL
HAAFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRIVR
NNFTLLTNLHGAPNKRSPAASQAPVTRVSLQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFKISSDTFVTYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFQNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDERSRDCQGLMEKFQFELTLEEEDSEGPEKEGEGPNYFSSTKTLCVIDPENRDSLE
ETDIDIATEDKSLIDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085147
n/a
NameBDBM50085147
Synonyms:8-(3-Nitro-phenyl)-6-o-tolyl-[1,7]naphthyridine | CHEMBL345360
TypeSmall organic molecule
Emp. Form.C21H15N3O2
Mol. Mass.341.3627
SMILESCc1ccccc1-c1cc2cccnc2c(n1)-c1cccc(c1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: