Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C
LigandBDBM50085146
Substrate/Competitorn/a
Meas. Tech.ChEMBL_155176
IC50 610±n/a nM
Citation Hersperger RBray-French KMazzoni LMüller T Palladium-catalyzed cross-coupling reactions for the synthesis of 6, 8-disubstituted 1,7-naphthyridines: a novel class of potent and selective phosphodiesterase type 4D inhibitors. J Med Chem 43:675-82 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4C
Name:Phosphodiesterase 4 and 5 (PDE4 and PDE5)
Synonyms:DPDE1 | PDE21 | PDE4C2 | Phosphodiesterase 4C
Type:PROTEIN
Mol. Mass.:79875.54
Organism:Homo sapiens (Human)
Description:ChEMBL_864910
Residue:712
Sequence:
MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERD
LSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQSSPGLGRIMQAPVPHSQRRESF
LYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQCLGA
AKQGPVGNPSSSNQLPPAEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMASNKFKRI
LNRELTHLSETSRSGNQVSEYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSA
SLSSATVPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAIIFSIFQERDLL
KTFQIPADTLATYLLMLEGHYHANVAYHNSLHAADVAQSTHVLLATPALEAVFTDLEILA
ALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQAENCDIFQNL
SAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQN
LVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGF
IDYIAHPLWETWADLVHPDAQDLLDTLEDNREWYQSKIPRSPSDLTNPERDGPDRFQFEL
TLEEAEEEDEEEEEEGEETALAKEALELPDTELLSPEAGPDPGDLPLDNQRT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085146
n/a
NameBDBM50085146
Synonyms:8-(3-Nitro-phenyl)-6-pyridin-3-yl-[1,7]naphthyridine | CHEMBL351613
TypeSmall organic molecule
Emp. Form.C19H12N4O2
Mol. Mass.328.3242
SMILES[O-][N+](=O)c1cccc(c1)-c1nc(cc2cccnc12)-c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: