Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4D
LigandBDBM50085144
Substrate/Competitorn/a
Meas. Tech.ChEMBL_155180
IC50 4100±n/a nM
Citation Hersperger RBray-French KMazzoni LMüller T Palladium-catalyzed cross-coupling reactions for the synthesis of 6, 8-disubstituted 1,7-naphthyridines: a novel class of potent and selective phosphodiesterase type 4D inhibitors. J Med Chem 43:675-82 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Synonyms:DPDE3 | PDE43 | PDE4D | Phosphodiesterase 4D
Type:Protein
Mol. Mass.:91092.69
Organism:Homo sapiens (Human)
Description:Q08499
Residue:809
Sequence:
MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPP
PPPSPQPQPQCPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRA
MDRTSYAVETGHRPGLKKSRMSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQA
NFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNF
AALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSV
SEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRP
MSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLST
PALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGF
KLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVL
LLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMC
DKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAP
DDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPL
DEQVEEEAVGEEEESQPEACVIDDRSPDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085144
n/a
NameBDBM50085144
Synonyms:8-(3-Nitro-phenyl)-[1,7]naphthyridine | CHEMBL351915
TypeSmall organic molecule
Emp. Form.C14H9N3O2
Mol. Mass.251.2402
SMILES[O-][N+](=O)c1cccc(c1)-c1nccc2cccnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: