Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin receptor
LigandBDBM50086011
Substrate/Competitorn/a
Meas. Tech.ChEMBL_105265
Ki 0.950±n/a nM
Citation Faust RGarratt PJJones RYeh LKTsotinis APanoussopoulou MCalogeropoulou TTeh MTSugden D Mapping the melatonin receptor. 6. Melatonin agonists and antagonists derived from 6H-isoindolo[2,1-a]indoles, 5,6-dihydroindolo[2,1-a]isoquinolines, and 6,7-dihydro-5H-benzo[c]azepino[2,1-a]indoles. J Med Chem 43:1050-61 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Melatonin receptor
Name:Melatonin receptor
Synonyms:MTNR1B | Mel-1B-R | Mel1b melatonin receptor | Melatonin 1B | Melatonin receptor | Melatonin receptor type 1B | Melatonin receptor type 2 (MT2)
Type:Enzyme
Mol. Mass.:40203.54
Organism:Homo sapiens (Human)
Description:P49286
Residue:362
Sequence:
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50086011
n/a
NameBDBM50086011
Synonyms:CHEMBL10110 | Cyclopropanecarboxylic acid [2-(2-methoxy-6H-isoindolo[2,1-a]indol-11-yl)-ethyl]-amide
TypeSmall organic molecule
Emp. Form.C22H22N2O2
Mol. Mass.346.4223
SMILESCOc1ccc2n3Cc4ccccc4-c3c(CCNC(=O)C3CC3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: