| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50369797 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_160747 (CHEMBL769061) |
|---|
| Ki | 3±n/a nM |
|---|
| Citation |  Fairlie, DP; Tyndall, JD; Reid, RC; Wong, AK; Abbenante, G; Scanlon, MJ; March, DR; Bergman, DA; Chai, CL; Burkett, BA Conformational selection of inhibitors and substrates by proteolytic enzymes: implications for drug design and polypeptide processing. J Med Chem43:1271-81 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50369797 |
|---|
| n/a |
|---|
| Name | BDBM50369797 |
|---|
| Synonyms: | CHEMBL1794029 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C39H57N5O7 |
|---|
| Mol. Mass. | 707.8992 |
|---|
| SMILES | CC[C@H](C)[C@@H]1NC(=O)[C@H](Cc2ccc(OCCCNC1=O)cc2)C(N)C[C@@H](O)[C@@H]1Cc2ccc(OCCCCC(=O)N[C@@H](C(C)C)C(=O)N1)cc2 |
|---|
| Structure | 
|
|---|
Search and Browse
