Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeprilysin
LigandBDBM50087085
Substrate/Competitorn/a
Meas. Tech.ChEMBL_140761
Ki 2.3±n/a nM
Citation Chen HNoble FMothé AMeudal HCoric PDanascimento SRoques BPGeorge PFournié-Zaluski MC Phosphinic derivatives as new dual enkephalin-degrading enzyme inhibitors: synthesis, biological properties, and antinociceptive activities. J Med Chem 43:1398-408 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neprilysin
Name:Neprilysin
Synonyms:Atriopeptidase | CD10 antigen | CD_antigen=CD10 | Enkephalinase | NEP | Neutral Endopeptidase | Neutral endopeptidase 24.11
Type:Enzyme
Mol. Mass.:85570.75
Organism:Oryctolagus cuniculus (rabbit)
Description:NEP was purified to homogeneity from rabbit kidney.
Residue:750
Sequence:
MGRSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTVIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD
VLQEPKTEDIVAVQKAKTLYRSCVNETAIDSRGGQPLLKLLPDVYGWPVATQNWEQTYGT
SWSAEKSIAQLNSNYGKKVLINFFVGTDDKNSMNHIIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMIAVAKLIRQEEGLPIDENQISVEMNKVMELEKEIANATTKSEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWSNFTNEIMSTVNINIPNEEDVVVYAPEYLIKLKPILT
KYFPRDFQNLFSWRFIMDLVSSLSRTYKDSRNAFRKALYGTTSESATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWITGAA
IVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSANNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKNGEEKLLPGIDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GSLQNSVEFSEAFQCPKNSYMNPEKKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50087085
n/a
NameBDBM50087085
Synonyms:(2S)-2-[(2S)-3-{[(1S)-1-azaniumyl-2-phenylethyl](hydroxy)phosphoryl}-2-[(4-phenylphenyl)methyl]propanamido]propanoic acid | 1-{[3-Biphenyl-4-yl-2-(1-carboxy-ethylcarbamoyl)-propyl]-hydroxy-phosphinoyl}-2-phenyl-ethyl-ammonium
TypeSmall organic molecule
Emp. Form.C27H32N2O5P
Mol. Mass.495.5266
SMILESC[C@H](NC(=O)[C@H](Cc1ccc(cc1)-c1ccccc1)CP(O)(=O)[C@H]([NH3+])Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: