Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 3
LigandBDBM50103417
Substrate/Competitorn/a
Meas. Tech.ChEMBL_200827
Ki 0.920±n/a nM
Citation Poitout LRoubert PContour-Galcéra MOMoinet CLannoy JPommier JPlas PBigg DThurieau C Identification of potent non-peptide somatostatin antagonists with sst(3) selectivity. J Med Chem 44:2990-3000 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Somatostatin receptor type 3
Name:Somatostatin receptor type 3
Synonyms:SOMATOSTATIN SST3 | SS-3-R | SS3-R | SS3R | SSR-28 | SSTR3 | Somatostatin receptor type 3 (SSTR3)
Type:Protein
Mol. Mass.:45855.97
Organism:Homo sapiens (Human)
Description:P32745
Residue:418
Sequence:
MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL
GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM
AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV
FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV
WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA
LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE
SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50103417
n/a
NameBDBM50103417
Synonyms:1,1-Dipentyl-3-(4-phenyl-1H-imidazol-2-yl)-2,3,4,9-tetrahydro-1H-beta-carboline | CHEMBL319458
TypeSmall organic molecule
Emp. Form.C30H38N4
Mol. Mass.454.6495
SMILESCCCCCC1(CCCCC)NC(Cc2c1[nH]c1ccccc21)c1nc(c[nH]1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: