Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-coupled receptor 80
LigandBDBM85777
Substrate/Competitorn/a
Meas. Tech.ChEMBL_151406
Ki 42±n/a nM
Citation Umino TYoshioka KSaitoh YMinakawa NNakata HMatsuda A Nucleosides and nucleotides. 200. Reinvestigation of 5'-N-ethylcarboxamidoadenosine derivatives: structure-activity relationships for P(3) purinoceptor-like proteins. J Med Chem 44:208-14 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
G protein-coupled receptor 80
Name:G protein-coupled receptor 80
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:38385.93
Organism:Rattus norvegicus
Description:ChEMBL_151406
Residue:337
Sequence:
MIETLDSPANDSDFLDYITALENCTDEQISFKMQYLPVIYSIIFLVGFPGNTVAISIYVF
KMRPWKSSTIIMLNLALTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFGFHFNLYSS
ILFLTCFSLFRYIVIIHPMSCFSIQKTRWAVVACAGVWVISLVAVMPMTFLITSTTRTNR
SACLDLTSSDDLTTIKWYNLILTATTFCLPLLIVTLCYTTIISTLTHGPRTHSCFKQKAR
RLTILLLLVFYVCFLPFHILRVIRIESRLLSISCSIESHIHEAYIVSRPLAALNTFGNLL
LYVVVSNNFQQAFCSAVRCKAIGDLEQAKKDSCSNNP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85777
n/a
NameBDBM85777
Synonyms:B-NECA
TypeSmall organic molecule
Emp. Form.C17H18N6O4
Mol. Mass.370.3626
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@@H]([C@@H](O)[C@H]1O)C(=O)NCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: