Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEDNRB
LigandBDBM50105033
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63840
Ki 130±n/a nM
Citation Morimoto HOhashi NShimadzu HKushiyama EKawanishi HHosaka TKawase YYasuda KKikkawa KYamauchi-Kohno RYamada K Potent and selective ET-A antagonists. 2. Discovery and evaluation of potent and water soluble N-(6-(2-(aryloxy)ethoxy)-4-pyrimidinyl)sulfonamide derivatives. J Med Chem 44:3369-77 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
EDNRB
Name:Endothelin receptor, ET-A/ET-B
Synonyms:ENDOTHELIN B | ET-B | Endothelin receptor ET-B | Endothelin receptor non-selective type | Endothelin receptor, ET-A/ET-B
Type:Enzyme Catalytic Domain
Mol. Mass.:49664.00
Organism:Homo sapiens (Human)
Description:ENDOTHELIN B EDNRB HUMAN::P24530
Residue:442
Sequence:
MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNA
SLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105033
n/a
NameBDBM50105033
Synonyms:CHEMBL112531 | N-{6-[2-(5-Bromo-pyrimidin-2-yloxy)-ethoxy]-5-p-tolyl-pyrimidin-4-yl}-4-tert-butyl-benzenesulfonamide
TypeSmall organic molecule
Emp. Form.C27H28BrN5O4S
Mol. Mass.598.511
SMILESCc1ccc(cc1)-c1c(NS(=O)(=O)c2ccc(cc2)C(C)(C)C)ncnc1OCCOc1ncc(Br)cn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: