Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin receptor ET-A
LigandBDBM50105054
Substrate/Competitorn/a
Meas. Tech.ChEMBL_65793
IC50 0.04±n/a nM
Citation Morimoto HOhashi NShimadzu HKushiyama EKawanishi HHosaka TKawase YYasuda KKikkawa KYamauchi-Kohno RYamada K Potent and selective ET-A antagonists. 2. Discovery and evaluation of potent and water soluble N-(6-(2-(aryloxy)ethoxy)-4-pyrimidinyl)sulfonamide derivatives. J Med Chem 44:3369-77 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Endothelin receptor ET-A
Name:Endothelin receptor ET-A
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:48707.29
Organism:Sus scrofa
Description:ChEMBL_65803
Residue:427
Sequence:
METFCFRVSFWVALLGCVISDNPESHSTNLSTHVDDFTTFRGTEFSLVVTTHRPTNLALP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFENHDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEEHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHEQNNHNTERS
SHKDSIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105054
n/a
NameBDBM50105054
Synonyms:4-tert-Butyl-N-{5-(4-hydroxymethyl-phenyl)-6-[2-(5-methylsulfanyl-pyrimidin-2-yloxy)-ethoxy]-pyrimidin-4-yl}-benzenesulfonamide | CHEMBL114298
TypeSmall organic molecule
Emp. Form.C28H31N5O5S2
Mol. Mass.581.706
SMILESCSc1cnc(OCCOc2ncnc(NS(=O)(=O)c3ccc(cc3)C(C)(C)C)c2-c2ccc(CO)cc2)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: