Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDelta-type opioid receptor
LigandBDBM50105072
Substrate/Competitorn/a
Meas. Tech.ChEMBL_145323
IC50 138±n/a nM
Citation Poulain RHorvath DBonnet BEckhoff CChapelain BBodinier MCDéprez B From hit to lead. Analyzing structure-profile relationships. J Med Chem 44:3391-401 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Delta-type opioid receptor
Name:Opioid receptors; mu/kappa/delta
Synonyms:D-OR-1 | DOR-1 | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRK1 | opioid receptor, delta 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40382.98
Organism:Homo sapiens (Human)
Description:Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor.
Residue:372
Sequence:
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105072
n/a
NameBDBM50105072
Synonyms:8-(6-Chloro-benzo[1,3]dioxol-5-ylmethyl)-1-phenyl-1,3,8-triaza-spiro[4.5]decan-4-one | CHEMBL115652
TypeSmall organic molecule
Emp. Form.C21H22ClN3O3
Mol. Mass.399.871
SMILESClc1cc2OCOc2cc1CN1CCC2(CC1)N(CNC2=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: