Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptors; D2 & D4
LigandBDBM50105101
Substrate/Competitorn/a
Meas. Tech.ChEMBL_61172
IC50 338±n/a nM
Citation Poulain RHorvath DBonnet BEckhoff CChapelain BBodinier MCDéprez B From hit to lead. Analyzing structure-profile relationships. J Med Chem 44:3391-401 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dopamine receptors; D2 & D4
Name:D2-like dopamine receptor
Synonyms:D(2C) dopamine receptor | D(4) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | Dopamine D4 receptor
Type:Enzyme
Mol. Mass.:48373.19
Organism:Homo sapiens (Human)
Description:P21917
Residue:467
Sequence:
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG
LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP
PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC
PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105101
n/a
NameBDBM50105101
Synonyms:4-[4,4-Bis-(4-fluoro-phenyl)-butyl]-piperazine-1-carboxylic acid 2-(4-fluoro-phenyl)-ethyl ester | CHEMBL325516
TypeSmall organic molecule
Emp. Form.C29H31F3N2O2
Mol. Mass.496.5638
SMILESFc1ccc(CCOC(=O)N2CCN(CCCC(c3ccc(F)cc3)c3ccc(F)cc3)CC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: