Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 reverse transcriptase
LigandBDBM50102273
Substrate/Competitorn/a
Meas. Tech.ChEMBL_196186
Ki 150±n/a nM
Citation Campiani GAiello FFabbrini MMorelli ERamunno AArmaroli SNacci VGarofalo AGreco GNovellino EMaga GSpadari SBergamini AVentura LBongiovanni BCapozzi MBolacchi FMarini SColetta MGuiso GCaccia S Quinoxalinylethylpyridylthioureas (QXPTs) as potent non-nucleoside HIV-1 reverse transcriptase (RT) inhibitors. Further SAR studies and identification of a novel orally bioavailable hydrazine-based antiviral agent. J Med Chem 44:305-15 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 reverse transcriptase
Name:Human immunodeficiency virus type 1 reverse transcriptase
Synonyms:Reverse transcriptase/RNaseH
Type:PROTEIN
Mol. Mass.:65229.15
Organism:Human immunodeficiency virus 1
Description:ChEMBL_1473730
Residue:566
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLRTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVLFLDGID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50102273
n/a
NameBDBM50102273
Synonyms:1-(5-Bromo-pyridin-2-yl)-3-[2-(6-fluoro-pyrrolo[1,2-a]quinoxalin-4-yloxy)-ethyl]-thiourea | CHEMBL418833
TypeSmall organic molecule
Emp. Form.C19H15BrFN5OS
Mol. Mass.460.323
SMILESFc1cccc2c1nc(OCCNC(=S)Nc1ccc(Br)cn1)c1cccn21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: