Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50102267
Substrate/Competitorn/a
Meas. Tech.ChEMBL_196188
Ki 70±n/a nM
Citation Campiani GAiello FFabbrini MMorelli ERamunno AArmaroli SNacci VGarofalo AGreco GNovellino EMaga GSpadari SBergamini AVentura LBongiovanni BCapozzi MBolacchi FMarini SColetta MGuiso GCaccia S Quinoxalinylethylpyridylthioureas (QXPTs) as potent non-nucleoside HIV-1 reverse transcriptase (RT) inhibitors. Further SAR studies and identification of a novel orally bioavailable hydrazine-based antiviral agent. J Med Chem 44:305-15 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50102267
n/a
NameBDBM50102267
Synonyms:1-(5-Bromo-pyridin-2-yl)-3-[2-(7-chloro-pyrrolo[1,2-a]quinoxalin-4-yloxy)-ethyl]-thiourea | CHEMBL105976
TypeSmall organic molecule
Emp. Form.C19H15BrClN5OS
Mol. Mass.476.777
SMILESClc1ccc2c(c1)nc(OCCNC(=S)Nc1ccc(Br)cn1)c1cccn21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: