Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptors; D2 & D4
LigandBDBM50095894
Substrate/Competitorn/a
Meas. Tech.ChEMBL_60684
Ki 1.9±n/a nM
Citation Rowley MBristow LJHutson PH Current and novel approaches to the drug treatment of schizophrenia. J Med Chem 44:477-501 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dopamine receptors; D2 & D4
Name:D2-like dopamine receptor
Synonyms:D(2C) dopamine receptor | D(4) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | Dopamine D4 receptor
Type:Enzyme
Mol. Mass.:48373.19
Organism:Homo sapiens (Human)
Description:P21917
Residue:467
Sequence:
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG
LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP
PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC
PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50095894
n/a
NameBDBM50095894
Synonyms:3-(4-Phenyl-piperazin-1-ylmethyl)-1H-pyrrolo[2,3-b]pyridine | CHEMBL357182
TypeSmall organic molecule
Emp. Form.C18H20N4
Mol. Mass.292.3782
SMILESC(N1CCN(CC1)c1ccccc1)c1c[nH]c2ncccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: