| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM50095996 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_103899 (CHEMBL711481) |
|---|
| Ki | 5800±n/a nM |
|---|
| Citation |  Orita, M; Yamamoto, S; Katayama, N; Aoki, M; Takayama, K; Yamagiwa, Y; Seki, N; Suzuki, H; Kurihara, H; Sakashita, H; Takeuchi, M; Fujita, S; Yamada, T; Tanaka, A Coumarin and chromen-4-one analogues as tautomerase inhibitors of macrophage migration inhibitory factor: discovery and X-ray crystallography. J Med Chem44:540-7 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12478.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14174 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
|---|
| BDBM50095996 |
|---|
| n/a |
|---|
| Name | BDBM50095996 |
|---|
| Synonyms: | 3-(7-Hydroxy-2-oxo-2H-chromen-3-yl)-3-oxo-propionic acid ethyl ester | CHEMBL153406 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H12O6 |
|---|
| Mol. Mass. | 276.2415 |
|---|
| SMILES | CCOC(=O)CC(=O)c1cc2ccc(O)cc2oc1=O |
|---|
| Structure | 
|
|---|
Search and Browse
