| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymase |
|---|
| Ligand | BDBM50098868 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_197662 (CHEMBL807472) |
|---|
| Ki | 3.56±n/a nM |
|---|
| Citation |  Akahoshi, F; Ashimori, A; Sakashita, H; Yoshimura, T; Eda, M; Imada, T; Nakajima, M; Mitsutomi, N; Kuwahara, S; Ohtsuka, T; Fukaya, C; Miyazaki, M; Nakamura, N Synthesis, structure-activity relationships, and pharmacokinetic profiles of nonpeptidic difluoromethylene ketones as novel inhibitors of human chymase. J Med Chem44:1297-304 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymase |
|---|
| Name: | Chymase |
|---|
| Synonyms: | Alpha-chymase | CMA1 | CMA1_HUMAN | CYH | CYM | Chymase precursor | Mast cell protease I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27340.12 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 247 |
|---|
| Sequence: | MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
|
|
|
|---|
| BDBM50098868 |
|---|
| n/a |
|---|
| Name | BDBM50098868 |
|---|
| Synonyms: | 4-[2-(5-Amino-6-oxo-2-m-tolyl-6H-pyrimidin-1-yl)-acetylamino]-2,2-difluoro-3-oxo-5-phenyl-pentanoic acid (2-azepan-1-yl-2-oxo-ethyl)-amide | CHEMBL26448 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H36F2N6O5 |
|---|
| Mol. Mass. | 622.6622 |
|---|
| SMILES | Cc1cccc(c1)-c1ncc(N)c(=O)n1CC(=O)NC(Cc1ccccc1)C(=O)C(F)(F)C(=O)NCC(=O)N1CCCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
