Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin G
LigandBDBM50098874
Substrate/Competitorn/a
Meas. Tech.ChEMBL_216699
Ki 1390±n/a nM
Citation Akahoshi FAshimori ASakashita HYoshimura TEda MImada TNakajima MMitsutomi NKuwahara SOhtsuka TFukaya CMiyazaki MNakamura N Synthesis, structure-activity relationships, and pharmacokinetic profiles of nonpeptidic difluoromethylene ketones as novel inhibitors of human chymase. J Med Chem 44:1297-304 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cathepsin G
Name:Cathepsin G
Synonyms:CG
Type:PROTEIN
Mol. Mass.:28860.08
Organism:Homo sapiens (Human)
Description:ChEMBL_1469016
Residue:255
Sequence:
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
TAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50098874
n/a
NameBDBM50098874
Synonyms:4-{2-[5-Amino-2-(3-chloro-phenyl)-6-oxo-6H-pyrimidin-1-yl]-acetylamino}-2,2-difluoro-3-oxo-5-phenyl-pentanoic acid benzylamide | CHEMBL24734
TypeSmall organic molecule
Emp. Form.C30H26ClF2N5O4
Mol. Mass.594.008
SMILESNc1cnc(-c2cccc(Cl)c2)n(CC(=O)NC(Cc2ccccc2)C(=O)C(F)(F)C(=O)NCc2ccccc2)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: