Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM50098668
Substrate/Competitorn/a
Meas. Tech.ChEMBL_218116
Ki 0.250000±n/a nM
Citation Hu BEllingboe JHan SLargis EMulvey ROliphant ASum FWTillett J (4-Piperidin-1-yl)phenyl amides: potent and selective human beta(3) agonists. J Med Chem 44:1456-66 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Beta-1 adrenergic receptor
Name:Adrenergic receptor
Synonyms:B1AR | Beta-1 adrenoceptor | Beta-1 adrenoreceptor | adrenergic Beta1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:51338.40
Organism:Homo sapiens (Human)
Description:n/a
Residue:477
Sequence:
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50098668
n/a
NameBDBM50098668
Synonyms:4-(3-tert-Butylamino-2-hydroxy-propoxy)-1,3-dihydro-benzoimidazol-2-one | CGP-12177A | CHEMBL36060
TypeSmall organic molecule
Emp. Form.C14H21N3O3
Mol. Mass.279.3348
SMILESCC(C)(C)NC[C@H](O)COc1cccc2[nH]c(=O)[nH]c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: