| Reaction Details |
|---|
 | Report a problem with these data |
| Target | B2 bradykinin receptor |
|---|
| Ligand | BDBM50113263 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_40444 (CHEMBL652383) |
|---|
| Ki | 0.6±n/a nM |
|---|
| Citation |  Dziadulewicz, EK; Ritchie, TJ; Hallett, A; Snell, CR; Davies, JW; Wrigglesworth, R; Dunstan, AR; Bloomfield, GC; Drake, GS; McIntyre, P; Brown, MC; Burgess, GM; Lee, W; Davis, C; Yaqoob, M; Phagoo, SB; Phillips, E; Perkins, MN; Campbell, EA; Davis, AJ; Rang, HP Nonpeptide bradykinin B2 receptor antagonists: conversion of rodent-selective bradyzide analogues into potent, orally-active human bradykinin B2 receptor antagonists. J Med Chem45:2160-72 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| B2 bradykinin receptor |
|---|
| Name: | B2 bradykinin receptor |
|---|
| Synonyms: | B2 BRADYKININ | B2 bradykinin receptor | B2R | BK-2 receptor | BKRB2_RAT | Bdkrb2 | Bradykinin B2 receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 44941.22 |
|---|
| Organism: | RAT |
|---|
| Description: | B2 BRADYKININ BDKRB2 RAT::P25023 |
|---|
| Residue: | 396 |
|---|
| Sequence: | MDTRSSLCPKTQAVVAVFWGPGCHLSTCIEMFNITTQALGSAHNGTFSEVNCPDTEWWSW
LNAIQAPFLWVLFLLAALENIFVLSVFCLHKTNCTVAEIYLGNLAAADLILACGLPFWAI
TIANNFDWLFGEVLCRVVNTMIYMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAK
LYSLVIWSCTLLLSSPMLVFRTMKDYREEGHNVTACVIVYPSRSWEVFTNMLLNLVGFLL
PLSIITFCTVRIMQVLRNNEMKKFKEVQTEKKATVLVLAVLGLFVLCWFPFQISTFLDTL
LRLGVLSGCWNERAVDIVTQISSYVAYSNSCLNPLVYVIVGKRFRKKSREVYQAICRKGG
CMGESVQMENSMGTLRTSISVDRQIHKLQDWAGNKQ
|
|
|
|---|
| BDBM50113263 |
|---|
| n/a |
|---|
| Name | BDBM50113263 |
|---|
| Synonyms: | (S)-1-[4-(4-benzhydrylthiosemicarbazido)-3-nitrobenzenesulfonyl]pyrrolidine-2-carboxylic acid{2-[(2-dimethylaminoethyl)methylamino]ethyl}amide(bradyzide) | CHEMBL308468 | CHEMBL431562 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H42N8O5S2 |
|---|
| Mol. Mass. | 682.856 |
|---|
| SMILES | CN(C)CCN(C)CCNC(=O)C1CCCN1S(=O)(=O)c1ccc(N[N-]C(=[SH+])NC(c2ccccc2)c2ccccc2)c(c1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
