Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty acid-binding protein 4 (FABP4)
LigandBDBM50152850
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29917
Kd 83000±n/a nM
Citation Cozzini PFornabaio MMarabotti AAbraham DJKellogg GEMozzarelli A Simple, intuitive calculations of free energy of binding for protein-ligand complexes. 1. Models without explicit constrained water. J Med Chem 45:2469-83 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Fatty acid-binding protein 4 (FABP4)
Name:Fatty acid-binding protein 4 (FABP4)
Synonyms:A-FABP | AFABP | ALBP | Adipocyte lipid-binding protein | Fatty acid binding protein adipocyte | Fatty acid-binding protein 4
Type:Enzyme
Mol. Mass.:14719.23
Organism:Homo sapiens (Human)
Description:P15090
Residue:132
Sequence:
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50152850
n/a
NameBDBM50152850
Synonyms:1-HEXYLDECANOIC ACID | CHEMBL82293 | Hexadecanoic acid | Hexadecanoic acid anion | Palmitic acid (PA)
TypeSmall organic molecule
Emp. Form.C16H32O2
Mol. Mass.256.4241
SMILESCCCCCCCCCCCCCCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: