| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, adipocyte |
|---|
| Ligand | BDBM50240485 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_29917 (CHEMBL641280) |
|---|
| Kd | 80000±n/a nM |
|---|
| Citation |  Cozzini, P; Fornabaio, M; Marabotti, A; Abraham, DJ; Kellogg, GE; Mozzarelli, A Simple, intuitive calculations of free energy of binding for protein-ligand complexes. 1. Models without explicit constrained water. J Med Chem45:2469-83 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, adipocyte |
|---|
| Name: | Fatty acid-binding protein, adipocyte |
|---|
| Synonyms: | A-FABP | AFABP | ALBP | Adipocyte lipid-binding protein | FABP4 | FABP4_HUMAN | Fatty acid binding protein adipocyte | Fatty acid-binding protein 4 | Fatty acid-binding protein 4 (FABP4) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 14719.23 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P15090 |
|---|
| Residue: | 132 |
|---|
| Sequence: | MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
|
|
|
|---|
| BDBM50240485 |
|---|
| n/a |
|---|
| Name | BDBM50240485 |
|---|
| Synonyms: | 18:0 | C18:0 | CH3-[CH2]16-COOH | CHEMBL46403 | Octadecanoic acid | Octadecansaeure | Oktadekansaeure | Stearinsaeure | acide octadecanoique | acide stearique | n-octadecanoic acid | octadecoic acid | stearic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H36O2 |
|---|
| Mol. Mass. | 284.4772 |
|---|
| SMILES | CCCCCCCCCCCCCCCCCC(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
