Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSaccharopepesin
LigandBDBM50005417
Substrate/Competitorn/a
Meas. Tech.ChEMBL_197598
Ki 14000±n/a nM
Citation Cozzini PFornabaio MMarabotti AAbraham DJKellogg GEMozzarelli A Simple, intuitive calculations of free energy of binding for protein-ligand complexes. 1. Models without explicit constrained water. J Med Chem 45:2469-83 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Saccharopepesin
Name:Saccharopepesin
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:44479.78
Organism:Saccharomyces cerevisiae
Description:ChEMBL_197598
Residue:405
Sequence:
MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHLGQKYLTQFEK
ANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSN
ECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAE
ATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTE
NGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI
TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGS
CISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005417
n/a
NameBDBM50005417
Synonyms:CHEMBL266334 | N-[(1-Cyclohexylmethyl-2,3-dihydroxy-5-methyl-hexylcarbamoyl)-ethylsulfanyl-methyl]-2-(morpholine-4-sulfonylamino)-3-phenyl-propionamide
TypeSmall organic molecule
Emp. Form.C31H52N4O7S2
Mol. Mass.656.897
SMILESCCSC(NC(=O)[C@H](Cc1ccccc1)NS(=O)(=O)N1CCOCC1)C(=O)N[C@@H](CC1CCCCC1)[C@@H](O)[C@@H](O)CC(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: