Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLipoxygenase-1
LigandBDBM50065996
Substrate/Competitorn/a
Meas. Tech.ChEMBL_169
IC50 170±n/a nM
Citation Whitman SGezginci MTimmermann BNHolman TR Structure-activity relationship studies of nordihydroguaiaretic acid inhibitors toward soybean, 12-human, and 15-human lipoxygenase. J Med Chem 45:2659-61 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Lipoxygenase-1
Name:Seed lipoxygenase-1
Synonyms:15-LOX | 15-Lipo-oxygenase (15-LO) | 15-lipo-oxygenase (SLO) | Arachidonic Acid 15- Lipoxygenase | L-1 | Lipoxygenase (LOX) | Lipoxygenase (SLO) | Seed lipoxygenase-1
Type:Enzyme
Mol. Mass.:94365.66
Organism:Glycine max (soybean)
Description:n/a
Residue:839
Sequence:
MFSAGHKIKGTVVLMPKNELEVNPDGSAVDNLNAFLGRSVSLQLISATKADAHGKGKVGK
DTFLEGINTSLPTLGAGESAFNIHFEWDGSMGIPGAFYIKNYMQVEFFLKSLTLEAISNQ
GTIRFVCNSWVYNTKLYKSVRIFFANHTYVPSETPAPLVSYREEELKSLRGNGTGERKEY
DRIYDYDVYNDLGNPDKSEKLARPVLGGSSTFPYPRRGRTGRGPTVTDPNTEKQGEVFYV
PRDENLGHLKSKDALEIGTKSLSQIVQPAFESAFDLKSTPIEFHSFQDVHDLYEGGIKLP
RDVISTIIPLPVIKELYRTDGQHILKFPQPHVVQVSQSAWMTDEEFAREMIAGVNPCVIR
GLEEFPPKSNLDPAIYGDQSSKITADSLDLDGYTMDEALGSRRLFMLDYHDIFMPYVRQI
NQLNSAKTYATRTILFLREDGTLKPVAIELSLPHSAGDLSAAVSQVVLPAKEGVESTIWL
LAKAYVIVNDSCYHQLMSHWLNTHAAMEPFVIATHRHLSVLHPIYKLLTPHYRNNMNINA
LARQSLINANGIIETTFLPSKYSVEMSSAVYKNWVFTDQALPADLIKRGVAIKDPSTPHG
VRLLIEDYPYAADGLEIWAAIKTWVQEYVPLYYARDDDVKNDSELQHWWKEAVEKGHGDL
KDKPWWPKLQTLEDLVEVCLIIIWIASALHAAVNFGQYPYGGLIMNRPTASRRLLPEKGT
PEYEEMINNHEKAYLRTITSKLPTLISLSVIEILSTHASDEVYLGQRDNPHWTSDSKALQ
AFQKFGNKLKEIEEKLVRRNNDPSLQGNRLGPVQLPYTLLYPSSEEGLTFRGIPNSISI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50065996
n/a
NameBDBM50065996
Synonyms:4-[(2S,3R)-4-(4-Hydroxy-3-methoxy-phenyl)-2,3-dimethyl-butyl]-benzene-1,2-diol | 4-[4-(4-Hydroxy-3-methoxy-phenyl)-2,3-dimethyl-butyl]-benzene-1,2-diol | CHEMBL316139
TypeSmall organic molecule
Emp. Form.C19H24O4
Mol. Mass.316.3915
SMILESCOc1cc(C[C@@H](C)[C@@H](C)Cc2ccc(O)c(O)c2)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: