Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target12-Lipoxygenase (12-LOX)
LigandBDBM50065996
Substrate/Competitorn/a
Meas. Tech.ChEMBL_209
IC50 14000±n/a nM
Citation Whitman SGezginci MTimmermann BNHolman TR Structure-activity relationship studies of nordihydroguaiaretic acid inhibitors toward soybean, 12-human, and 15-human lipoxygenase. J Med Chem 45:2659-61 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
12-Lipoxygenase (12-LOX)
Name:Arachidonate 12-lipoxygenase
Synonyms:12-LOX | Arachidonate 12-lipoxygenase | Arachidonate 12-lipoxygenase, 12S-type | Platelet 12-lipoxygenase | Platelet-type lipoxygenase 12
Type:Protein
Mol. Mass.:75689.18
Organism:Homo sapiens (Human)
Description:P18054
Residue:663
Sequence:
MGRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFDHDVAEDLGLL
QFVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNA
LDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKA
GALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPML
LRRSTSLPSRLVLPSGMEELQAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL
VMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYH
LLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVST
GGGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVH
LFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQH
AAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRR
QPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENS
VTI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50065996
n/a
NameBDBM50065996
Synonyms:4-[(2S,3R)-4-(4-Hydroxy-3-methoxy-phenyl)-2,3-dimethyl-butyl]-benzene-1,2-diol | 4-[4-(4-Hydroxy-3-methoxy-phenyl)-2,3-dimethyl-butyl]-benzene-1,2-diol | CHEMBL316139
TypeSmall organic molecule
Emp. Form.C19H24O4
Mol. Mass.316.3915
SMILESCOc1cc(C[C@@H](C)[C@@H](C)Cc2ccc(O)c(O)c2)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: