Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y12
LigandBDBM50118225
Substrate/Competitorn/a
Meas. Tech.ChEMBL_147743
IC50 0.400000±n/a nM
Citation Jacobson KAJarvis MFWilliams M Purine and pyrimidine (P2) receptors as drug targets. J Med Chem 45:4057-93 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y12
Name:Purinergic receptor P2Y12
Synonyms:ADP-glucose receptor | ADPG-R | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | SP1999
Type:Enzyme
Mol. Mass.:39458.48
Organism:Homo sapiens (Human)
Description:Q9H244
Residue:342
Sequence:
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118225
n/a
NameBDBM50118225
Synonyms:ARL 69931MX | Adenosine triphosphate derivative | CHEMBL334966 | Cangrelor
TypeSmall organic molecule
Emp. Form.C17H25Cl2F3N5O12P3S2
Mol. Mass.776.359
SMILESCSCCNc1nc(SCCC(F)(F)F)nc2n(cnc12)[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)C(Cl)(Cl)P(O)(O)=O)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: