Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 3
LigandBDBM50118232
Substrate/Competitorn/a
Meas. Tech.ChEMBL_147403
EC50 350±n/a nM
Citation Jacobson KAJarvis MFWilliams M Purine and pyrimidine (P2) receptors as drug targets. J Med Chem 45:4057-93 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
P2X purinoceptor 3
Name:P2X purinoceptor 3
Synonyms:ATP receptor | P2RX3 | P2X purinoceptor 3 (P2RX3) | P2X purinoceptor 3 (P2X3) | P2X3 | P2X3 purinoceptor | Purinergic receptor
Type:Protein
Mol. Mass.:44292.02
Organism:Homo sapiens (Human)
Description:P56373
Residue:397
Sequence:
MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDS
QCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEE
VNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118232
n/a
NameBDBM50118232
Synonyms:2-MeSATP | ATP, 2-meS | CHEMBL336208
TypeSmall organic molecule
Emp. Form.C11H18N5O13P3S
Mol. Mass.553.273
SMILESCSc1nc(N)c2ncn([C@@H]3O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]3O)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: