Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2A
LigandBDBM50108700
Substrate/Competitorn/a
Meas. Tech.ChEMBL_2290
Ki 1.8±n/a nM
Citation Fletcher SRBurkamp FBlurton PCheng SKClarkson RO'Connor DSpinks DTudge Mvan Niel MBPatel SChapman KMarwood RShepheard SBentley GCook GPBristow LJCastro JLHutson PHMacLeod AM 4-(Phenylsulfonyl)piperidines: novel, selective, and bioavailable 5-HT(2A) receptor antagonists. J Med Chem 45:492-503 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 2A
Name:Dopamine D2 receptor and serotonin 2a receptor
Synonyms:5-HT-2 | 5-HT-2A | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT-2A) | 5-hydroxytryptamine receptor 2A (5HT-2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | HTR2 | HTR2A | Serotonin receptor 2A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52607.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:471
Sequence:
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50108700
n/a
NameBDBM50108700
Synonyms:1'-(2,4-difluorophenethyl)-6-methoxyspiro[3,4-dihydro-2H-chromene-2,4'-(hexahydropyridine)] | 1'-(2,4-difluorophenethyl)-6-methoxyspiro[chroman-2,4'-piperidine] | CHEMBL146233
TypeSmall organic molecule
Emp. Form.C22H25F2NO2
Mol. Mass.373.4362
SMILESCOc1ccc2OC3(CCN(CCc4ccc(F)cc4F)CC3)CCc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: