Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(2) dopamine receptor
LigandBDBM50108691
Substrate/Competitorn/a
Meas. Tech.ChEMBL_87873
Ki 490±n/a nM
Citation Fletcher SRBurkamp FBlurton PCheng SKClarkson RO'Connor DSpinks DTudge Mvan Niel MBPatel SChapman KMarwood RShepheard SBentley GCook GPBristow LJCastro JLHutson PHMacLeod AM 4-(Phenylsulfonyl)piperidines: novel, selective, and bioavailable 5-HT(2A) receptor antagonists. J Med Chem 45:492-503 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
D(2) dopamine receptor
Name:Dopamine receptor D2L/neurotensin receptor NTS1
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DRD2 | Dopamine D2 receptor | Dopamine D2 receptor (D2) | Dopamine D2 receptor (D2R) | Dopamine D2A | Dopamine2-like
Type:Cell-surface receptors
Mol. Mass.:50647.10
Organism:Homo sapiens (Human)
Description:P14416
Residue:443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50108691
n/a
NameBDBM50108691
Synonyms:1'-(2,4-difluorophenethyl)-7-fluorospiro[3,4-dihydro-2H-chromene-2,4'-(hexahydropyridine)] | CHEMBL148348
TypeSmall organic molecule
Emp. Form.C21H22F3NO
Mol. Mass.361.4007
SMILESFc1ccc(CCN2CCC3(CC2)CCc2ccc(F)cc2O3)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: