Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A1 receptor
LigandBDBM50003019
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29113
Ki 0.19±n/a nM
Citation Bondavalli FBotta MBruno OCiacci ACorelli FFossa PLucacchini AManetti FMartini CMenozzi GMosti LRanise ASchenone STafi ATrincavellic ML Synthesis, molecular modeling studies, and pharmacological activity of selective A(1) receptor antagonists. J Med Chem 45:4875-87 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosine A1 receptor
Name:Adenosine A1 receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low
Type:Enzyme Catalytic Domain
Mol. Mass.:36602.99
Organism:BOVINE
Description:ADENOSINE 0 BOVINE::P28190
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPRTYFHTCLKVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
PRRAVVAITGCWILSFVVGLTPMFGWNNLSAVERDWLANGSVGEPVIECQFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYMEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHMPRILIYIAIFLSHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPVDEDAPAERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003019
n/a
NameBDBM50003019
Synonyms:8-(Hexahydro-2,5-methano-pentalen-3a-yl)-1,3-dipropyl-3,7-dihydro-purine-2,6-dione | CHEMBL52333 | KW-3902
TypeSmall organic molecule
Emp. Form.C20H28N4O2
Mol. Mass.356.4619
SMILESCCCn1c2nc([nH]c2c(=O)n(CCC)c1=O)C12CC3CC1CC(C2)C3 |THB:22:21:18:24.23.25,22:23:18:21.20|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: