| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 5 |
|---|
| Ligand | BDBM50121260 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_106527 (CHEMBL872337) |
|---|
| IC50 | 1.2±n/a nM |
|---|
| Citation |  Grieco, P; Lavecchia, A; Cai, M; Trivedi, D; Weinberg, D; MacNeil, T; Van der Ploeg, LH; Hruby, VJ Structure-activity studies of the melanocortin peptides: discovery of potent and selective affinity antagonists for the hMC3 and hMC4 receptors. J Med Chem45:5287-94 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 5 |
|---|
| Name: | Melanocortin receptor 5 |
|---|
| Synonyms: | MC-2 | MC5-R | MC5R | MC5R_HUMAN | Melanocortin MC5 | Melanocortin receptor (M4 and M5) | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36612.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33032 |
|---|
| Residue: | 325 |
|---|
| Sequence: | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
|
|
|
|---|
| BDBM50121260 |
|---|
| n/a |
|---|
| Name | BDBM50121260 |
|---|
| Synonyms: | 3-(2-Acetylamino-hexanoylamino)-17-[3-(diaminomethaniminium)-propyl]-14-(1H-indol-3-ylmethyl)-20-naphthalen-2-ylmethyl-2,5,13,16,19,22-hexaoxo-1,6,12,15,18,21-hexaaza-tricyclo[21.8.0.0*25,30*]hentriaconta-25(30),26,28-triene-11-carboxylic acid amide | CHEMBL2372589 | CID44366183 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C58H73N13O9 |
|---|
| Mol. Mass. | 1096.2819 |
|---|
| SMILES | [H][C@@]12Cc3ccccc3CN1C(=O)[C@@H](CC(=O)NCCCC[C@H](NC(=O)[C@H](Cc1c[nH]c3ccccc13)NC(=O)[C@@H](CCCNC(N)=N)NC(=O)[C@H](Cc1ccc3ccccc3c1)NC2=O)C(N)=O)NC(=O)[C@@H](CCCC)NC(C)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
