| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Human immunodeficiency virus type 1 protease |
|---|
| Ligand | BDBM50121521 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158026 |
|---|
| Ki | 0.910000±n/a nM |
|---|
| Kd | 48±n/a nM |
|---|
| KON | 1850000 M-1s-1 |
|---|
| Citation |  Markgren PO; Schaal W; Hämäläinen M; Karlén A; Hallberg A; Samuelsson B; Danielson UH Relationships between structure and interaction kinetics for HIV-1 protease inhibitors. J Med Chem 45:5430-9 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Human immunodeficiency virus type 1 protease |
|---|
| Name: | Human immunodeficiency virus type 1 protease |
|---|
| Synonyms: | Pol polyprotein |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | n/a |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50121521 |
|---|
| n/a |
|---|
| Name | BDBM50121521 |
|---|
| Synonyms: | 2-({2,5-Bis-benzyloxy-5-[(1-carboxy-2-methyl-butyl)-methyl-carbamoyl]-3,4-dihydroxy-pentanoyl}-methyl-amino)-3-methyl-pentanoic acid | CHEMBL149472 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H48N2O10 |
|---|
| Mol. Mass. | 644.7523 |
|---|
| SMILES | CCC(C)C(N(C)C(=O)[C@H](OCc1ccccc1)[C@H](O)[C@@H](O)[C@@H](OCc1ccccc1)C(=O)N(C)C(C(C)CC)C(O)=O)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
