Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50121502
Substrate/Competitorn/a
Meas. Tech.ChEMBL_158026
Ki 0.6±n/a nM
Kd 14±n/a nM
KON 6390000 M-1s-1
Citation Markgren POSchaal WHämäläinen MKarlén AHallberg ASamuelsson BDanielson UH Relationships between structure and interaction kinetics for HIV-1 protease inhibitors. J Med Chem 45:5430-9 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121502
n/a
NameBDBM50121502
Synonyms:2,5-Bis-benzyloxy-3,4-dihydroxy-hexanedioic acid bis-[(2-hydroxy-indan-1-yl)-amide] | CHEMBL264040
TypeSmall organic molecule
Emp. Form.C38H40N2O8
Mol. Mass.652.7328
SMILESO[C@H]([C@@H](O)[C@@H](OCc1ccccc1)C(=O)NC1[C@H](O)Cc2ccccc12)[C@@H](OCc1ccccc1)C(=O)NC1[C@@H](O)Cc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: