Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50108918
Substrate/Competitorn/a
Meas. Tech.ChEMBL_70854
IC50 4740±n/a nM
Citation Balboni GSalvadori SGuerrini RNegri LGiannini EJinsmaa YBryant SDLazarus LH Potent delta-opioid receptor agonists containing the Dmt-Tic pharmacophore. J Med Chem 45:5556-63 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50108918
n/a
NameBDBM50108918
Synonyms:(2S)-2-({2-[(2S)-2-amino-3-(4-hydroxy-2,6-dimethylphenyl)propanoyl]-1,2,3,4-tetrahydroisoquinolin-3-yl}formamido)propanamide | 2-[2-Amino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-1,2,3,4-tetrahydro-isoquinoline-3-carboxylic acid (1-carbamoyl-ethyl)-amide
TypeSmall organic molecule
Emp. Form.C24H30N4O4
Mol. Mass.438.5194
SMILESC[C@H](NC(=O)C1Cc2ccccc2CN1C(=O)[C@@H](N)Cc1c(C)cc(O)cc1C)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: