Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMast cell carboxypeptidase A
LigandBDBM50121929
Substrate/Competitorn/a
Meas. Tech.ChEMBL_45636
Ki 450±n/a nM
Citation Patchett AA 2002 Alfred Burger Award Address in Medicinal Chemistry. Natural products and design: interrelated approaches in drug discovery. J Med Chem 45:5609-16 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Mast cell carboxypeptidase A
Name:Mast cell carboxypeptidase A
Synonyms:Carboxypeptidase A3 | MC-CPA
Type:PROTEIN
Mol. Mass.:48684.88
Organism:Homo sapiens (Human)
Description:ChEMBL_45634
Residue:417
Sequence:
MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHV
AANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYN
NWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREW
VSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKN
QNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVY
ITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISG
SSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121929
n/a
NameBDBM50121929
Synonyms:(phenylmethyl)butanedioic acid | 2-benzylbutanedioic acid | 2-benzylsuccinic acid | CHEMBL151284 | alpha-benzylsuccinic acid | benzylsuccinic acid | beta-carboxybenzenebutanoic acid
TypeSmall organic molecule
Emp. Form.C11H12O4
Mol. Mass.208.2106
SMILESOC(=O)CC(Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: