Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 2
LigandBDBM50103430
Substrate/Competitorn/a
Meas. Tech.ChEMBL_200680
Ki 0.01±n/a nM
Citation Patchett AA 2002 Alfred Burger Award Address in Medicinal Chemistry. Natural products and design: interrelated approaches in drug discovery. J Med Chem 45:5609-16 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Somatostatin receptor type 2
Name:Somatostatin receptor type 2
Synonyms:SOMATOSTATIN SST2 | SRIF-1 | SS-2-R | SS2-R | SS2R | SSTR2 | Somatostatin receptor type 2 (SSTR2)
Type:Enzyme
Mol. Mass.:41344.94
Organism:Homo sapiens (Human)
Description:P30874
Residue:369
Sequence:
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50103430
n/a
NameBDBM50103430
Synonyms:6-Amino-2-(3-(1H-indol-3-yl)-2-{[4-(2-oxo-2,3-dihydro-benzoimidazol-1-yl)-piperidine-1-carbonyl]-amino}-butyrylamino)-hexanoic acid tert-butyl ester | CHEMBL99895
TypeSmall organic molecule
Emp. Form.C35H47N7O5
Mol. Mass.645.7916
SMILESC[C@H]([C@@H](NC(=O)N1CCC(CC1)n1c2ccccc2[nH]c1=O)C(=O)N[C@@H](CCCCN)C(=O)OC(C)(C)C)c1c[nH]c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: