Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 1 |
---|
Ligand | BDBM9503 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_50321 (CHEMBL660790) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Manley, PW; Furet, P; Bold, G; Brüggen, J; Mestan, J; Meyer, T; Schnell, CR; Wood, J; Haberey, M; Huth, A; Krüger, M; Menrad, A; Ottow, E; Seidelmann, D; Siemeister, G; Thierauch, KH Anthranilic acid amides: a novel class of antiangiogenic VEGF receptor kinase inhibitors. J Med Chem45:5687-93 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 1 |
---|
Name: | Cyclin-dependent kinase 1 |
Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
Type: | Enzyme Subunit |
Mol. Mass.: | 34101.08 |
Organism: | Homo sapiens (Human) |
Description: | P06493 |
Residue: | 297 |
Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
BDBM9503 |
---|
n/a |
---|
Name | BDBM9503 |
Synonyms: | 2-[(pyridin-4-ylmethyl)amino]-N-[3-(trifluoromethyl)phenyl]benzamide | CHEMBL153843 | anthranyl amide derivative C |
Type | Small organic molecule |
Emp. Form. | C20H16F3N3O |
Mol. Mass. | 371.3557 |
SMILES | FC(F)(F)c1cccc(NC(=O)c2ccccc2NCc2ccncc2)c1 |
Structure |
|