Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase IV
LigandBDBM50292100
Substrate/Competitorn/a
Meas. Tech.ChEMBL_45265
Ki 4±n/a nM
Citation Scozzafava AMenabuoni LMincione FSupuran CT Carbonic anhydrase inhibitors. A general approach for the preparation of water-soluble sulfonamides incorporating polyamino-polycarboxylate tails and of their metal complexes possessing long-lasting, topical intraocular pressure-lowering properties. J Med Chem 45:1466-76 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase IV
Name:Carbonic anhydrase
Synonyms:CA-IV | Carbonate dehydratase IV | Carbonic anhydrase 4
Type:Enzyme
Mol. Mass.:35152.74
Organism:Bos taurus (bovine)
Description:Bovine isozyme, isolated from lung microsomes
Residue:312
Sequence:
MRLLLALLVLAAAPPQARAASHWCYQIQVKPSNYTCLEPDEWEGSCQNNRQSPVNIVTAK
TQLDPNLGRFSFSGYNMKHQWVVQNNGHTVMVLLENKPSIAGGGLSTRYQATQLHLHWSR
AMDRGSEHSFDGERFAMEMHIVHEKEKGLSGNASQNQFAEDEIAVLAFMVEDGSKNVNFQ
PLVEALSDIPRPNMNTTMKEGVSLFDLLPEEESLRHYFRYLGSLTTPTCDEKVVWTVFQK
PIQLHRDQILAFSQKLFYDDQQKVNMTDNVRPVQSLGQRQVFRSGAPGLLLAQPLPTLLA
PVLACLTVGFLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50292100
n/a
NameBDBM50292100
Synonyms:CHEMBL284354 | {{2-[2-(2-{Carboxymethyl-[(2-sulfamoyl-benzothiazol-6-ylcarbamoyl)-methyl]-amino}-ethoxy)-ethoxy]-ethyl}-[(2-sulfamoyl-benzothiazol-6-ylcarbamoyl)-methyl]-amino}-acetic acid
TypeSmall organic molecule
Emp. Form.C28H34N8O12S4
Mol. Mass.802.876
SMILESNS(=O)(=O)c1nc2ccc(NC(=O)CN(CCOCCOCCN(CC(O)=O)CC(=O)Nc3ccc4nc(sc4c3)S(N)(=O)=O)CC(O)=O)cc2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: