| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 4 |
|---|
| Ligand | BDBM50228325 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_45265 (CHEMBL658217) |
|---|
| Ki | 5±n/a nM |
|---|
| Citation |  Scozzafava, A; Menabuoni, L; Mincione, F; Supuran, CT Carbonic anhydrase inhibitors. A general approach for the preparation of water-soluble sulfonamides incorporating polyamino-polycarboxylate tails and of their metal complexes possessing long-lasting, topical intraocular pressure-lowering properties. J Med Chem45:1466-76 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase 4 |
|---|
| Name: | Carbonic anhydrase 4 |
|---|
| Synonyms: | CA-IV | CA4 | CAH4_BOVIN | Carbonate dehydratase IV | Carbonic Anhydrase IV | Carbonic anhydrase | Carbonic anhydrase 4 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 35152.74 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | Bovine isozyme, isolated from lung microsomes |
|---|
| Residue: | 312 |
|---|
| Sequence: | MRLLLALLVLAAAPPQARAASHWCYQIQVKPSNYTCLEPDEWEGSCQNNRQSPVNIVTAK
TQLDPNLGRFSFSGYNMKHQWVVQNNGHTVMVLLENKPSIAGGGLSTRYQATQLHLHWSR
AMDRGSEHSFDGERFAMEMHIVHEKEKGLSGNASQNQFAEDEIAVLAFMVEDGSKNVNFQ
PLVEALSDIPRPNMNTTMKEGVSLFDLLPEEESLRHYFRYLGSLTTPTCDEKVVWTVFQK
PIQLHRDQILAFSQKLFYDDQQKVNMTDNVRPVQSLGQRQVFRSGAPGLLLAQPLPTLLA
PVLACLTVGFLR
|
|
|
|---|
| BDBM50228325 |
|---|
| n/a |
|---|
| Name | BDBM50228325 |
|---|
| Synonyms: | CHEMBL1795059 | CHEMBL34546 | {(2-{Carboxymethyl-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-ethyl)-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-acetic acid | {(2-{Carboxymethyl-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-ethyl)-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-acetic acid compound with Zn complex | {(2-{Carboxymethyl-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-ethyl)-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-acetic acid; compound with Al complex | {(2-{Carboxymethyl-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-ethyl)-[(5-sulfamoyl-[1,3,4]thiadiazol-2-ylcarbamoyl)-methyl]-amino}-acetic acid; compound with Cu complex |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H20N10O10S4 |
|---|
| Mol. Mass. | 616.63 |
|---|
| SMILES | NS(=O)(=O)c1nnc(NC(=O)CN(CCN(CC(O)=O)CC(=O)Nc2nnc(s2)S(N)(=O)=O)CC(O)=O)s1 |
|---|
| Structure | 
|
|---|
Search and Browse
