Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutathione S-transferase A2
LigandBDBM50111440
Substrate/Competitorn/a
Meas. Tech.ChEMBL_72328
IC50 5±n/a nM
Citation Toogood PL Inhibition of protein-protein association by small molecules: approaches and progress. J Med Chem 45:1543-58 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Glutathione S-transferase A2
Name:Glutathione S-transferase A2
Synonyms:GST class-alpha member 2 | GST-gamma | GSTA2-2 | GTH2 | HA subunit 2
Type:PROTEIN
Mol. Mass.:25667.17
Organism:Homo sapiens (Human)
Description:ChEMBL_799590
Residue:222
Sequence:
MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAK
LALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50111440
n/a
NameBDBM50111440
Synonyms:4-(1-carbamoyl-4-methylpentanamide-2-yl-cyclopropylcarbamoyl)-4-{2-(6-chloro-1H-3-indolyl)-1-[1-{1-methyl-1-[1-(1-methylcarboxamido-2-phenylethylcarboxamido)-3-methylsulfanylpropylcarboxamido]ethylcarboxamido}-2-(4-methylphosphatephenyl)ethylcarboxamido]ethylcarboxamido}butanoic acid | Ac-Phe-Met-Aib-Pmp-6-Cl-Trp-Glu-Ac3c-Leu-NH2, GST-hdm2 binding peptide | CID44286587
TypeSmall organic molecule
Emp. Form.C56H72ClN10O14PS
Mol. Mass.1207.722
SMILESCSCC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(C)=O)C(=O)NC(C)(C)C(=O)N[C@@H](Cc1ccc(CP([O-])([O-])=O)cc1)C(=O)N[C@@H](Cc1c[nH]c2cc(Cl)ccc12)C(=O)N[C@@H](CCC(O)=O)C(=O)NC1(CC1)C(=O)N[C@@H](CC(C)C)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: