Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC5a anaphylatoxin chemotactic receptor (C5aR)
LigandBDBM50111445
Substrate/Competitorn/a
Meas. Tech.ChEMBL_41607
IC50 300±n/a nM
Citation Toogood PL Inhibition of protein-protein association by small molecules: approaches and progress. J Med Chem 45:1543-58 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
C5a anaphylatoxin chemotactic receptor (C5aR)
Name:C5a anaphylatoxin chemotactic receptor
Synonyms:C5a anaphylatoxin chemotactic receptor | C5a-R | C5aR | CD_antigen=CD88
Type:Enzyme
Mol. Mass.:39347.68
Organism:Homo sapiens (Human)
Description:P21730
Residue:350
Sequence:
MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50111445
n/a
NameBDBM50111445
Synonyms:(S)-N-((3R,6S,9S,15S,20aS)-6-((1H-indol-3-yl)methyl)-3-(cyclohexylmethyl)-9-(3-guanidinopropyl)-1,4,7,10,16-pentaoxoicosahydropyrrolo[1,2-a][1,4,7,10,13]pentaazacyclooctadecin-15-yl)-2-acetamido-3-phenylpropanamide | Ac-Phe-[Orn-Pro-cha-Trp-Arg] | CHEMBL41547 | [1-[1-(6-Carbamoyl-cyclohex-2-enylcarbamoyl)-cyclohexylcarbamoyl]-2-(4-phosphonooxy-phenyl)-ethyl]-carbamic acid 3-amino-benzyl ester
TypeSmall organic molecule
Emp. Form.C47H65N11O7
Mol. Mass.896.0885
SMILESCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H]1CCCNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@@H](CC2CCCCC2)NC(=O)[C@@H]2CCCN2C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: